Recombinant Human PIH1D3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens dynein axonemal assembly factor 6 (DNAAF6), transcript variant 2 (NM_173494).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NQM4
Entry Name DAAF6_HUMAN
Gene Names DNAAF6 CXorf41 PIH1D3
Alternative Gene Names CXorf41 PIH1D3
Alternative Protein Names Dynein axonemal assembly factor 6 (PIH1 domain-containing protein 3) (Sarcoma antigen NY-SAR-97)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 214
Molecular Weight(Da) 24069
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF
Background
Function FUNCTION: Plays a role in cytoplasmic pre-assembly of axonemal dynein. {ECO:0000269|PubMed:28041644, ECO:0000269|PubMed:28176794}.
Pathway
Protein Families PIH1 family
Tissue Specificity Expressed in testis, small intestine, prostate, adrenal gland, spleen, lung, bladder, breast and ovary. Expressed in ciliated epithelial cells (PubMed:28176794). {ECO:0000269|PubMed:12601173, ECO:0000269|PubMed:28176794}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8086627

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PIH1D3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.